Structure of PDB 7qi5 Chain AK

Receptor sequence

>7qi5AK (length=101) Species: 9606 (Homo sapiens) [Search protein sequence]

HYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAA
LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAT
W

3D structure

PDB

7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.

Chain

Resolution

2.63 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	H28 Y29 D31 W32 R33 W35 R36 R40 R51 N55 R58 I75 R80 C83 V85 R86 R88 N89 R90 T94 R96 P97 R98 G99 K101 R102 R108 I109 R112 T127 W128	H1 Y2 D4 W5 R6 W8 R9 R13 R24 N28 R31 I48 R53 C56 V58 R59 R61 N62 R63 T67 R69 P70 R71 G72 K74 R75 R81 I82 R85 T100 W101

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0031965	nuclear membrane
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
PDBsum	7qi5
PubMed	38769321
UniProt	O60783\|RT14_HUMAN Small ribosomal subunit protein uS14m (Gene Name=MRPS14)