Structure of PDB 7q08 Chain AK

Receptor sequence

>7q08AK (length=86) Species: 237561 (Candida albicans SC5314)

GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT

3D structure

• PDB: 7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: AK
• Resolution: 2.56 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	G2 K3 G4 T5 P6 S7 L8 G9 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 K31 S35 K43 M44 R45 H47 N48 W49 K52 R55 R56	G1 K2 G3 T4 P5 S6 L7 G8 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 K30 S34 K42 M43 R44 H46 N47 W48 K51 R54 R55
BS02	rna	AK	R21 C22 V29 T59 G60 G62 R63 M64 Y66 L67 K68 V70 R72 F74 K75 N76 Q79 T80 G81 V82 A83 Q86	R20 C21 V28 T58 G59 G61 R62 M63 Y65 L66 K67 V69 R71 F73 K74 N75 Q78 T79 G80 V81 A82 Q85
BS03	ZN	AK	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q08, PDBe:7q08, PDBj:7q08
• PDBsum: 7q08
• PubMed: 35613268
• UniProt: A0A1D8PF45|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)