Structure of PDB 7o0w Chain AK

Receptor sequence
>7o0wAK (length=49) Species: 1379270 (Gemmatimonas phototrophica) [Search protein sequence]
MHRIWMGTDPHIIMSALGSFLVGAVLVMHIWAYGQFNWPATLKAKYATP
3D structure
PDB7o0w 2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.
ChainAK
Resolution2.47 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 BCL AK M14 S15 G18 V22 M14 S15 G18 V22
BS02 BCL AK V22 V25 H29 A32 W38 V22 V25 H29 A32 W38
BS03 BCL AK F20 G23 F20 G23
BS04 BCL AK M1 I4 W5 F20 M1 I4 W5 F20
BS05 V7N AK M1 R3 I4 M1 R3 I4
BS06 V7N AK L21 W31 L21 W31
BS07 BCL AK V25 M28 H29 W31 F36 V25 M28 H29 W31 F36
Gene Ontology
--> -->
 
 
UnboundLocalError
Python 3.6.8: /usr/bin/python3
Fri Feb 21 21:25:06 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7o0w', asym_id = 'AK', title = '2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7o0w', asym_id='AK', title='2.4- angstrom structure of the double-ring Gemmatimonas phototrophica photosystem.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0016020,0019684,0030077,0045156', uniprot = '', pdbid = '7o0w', asym_id = 'AK'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0016020,0019684,0030077,0045156', uniprot='', pdbid='7o0w', asym_id='AK')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>