Structure of PDB 6ztm Chain AK

Receptor sequence
>6ztmAK (length=116) Species: 562 (Escherichia coli) [Search protein sequence]
KQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFAA
QVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITDV
TPIPHNGCRPPKKRRV
3D structure
PDB6ztm Structural basis of transcription-translation coupling and collision in bacteria.
ChainAK
Resolution3.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AK H22 N28 N29 T33 G39 N40 A41 W44 T46 G48 G49 R53 G54 S55 K57 K87 P115 I116 H118 N119 C121 R122 K125 R127 R128 H9 N15 N16 T20 G26 N27 A28 W31 T33 G35 G36 R40 G41 S42 K44 K74 P102 I103 H105 N106 C108 R109 K112 R114 R115
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ztm, PDBe:6ztm, PDBj:6ztm
PDBsum6ztm
PubMed32820062
UniProtP0A7R9|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]