Structure of PDB 6nu2 Chain AK

Receptor sequence

>6nu2AK (length=101) Species: 9606 (Homo sapiens)

HYVDWRMWRDVKRRKMAYEYADERLRINSLRKNTILPKILQDVADEEIAA
LPRDSCPVRIRNRCVMTSRPRGVKRRWRLSRIVFRHLADHGQLSGIQRAT
W

3D structure

• PDB: 6nu2 Structural insights into unique features of the human mitochondrial ribosome recycling.
• Chain: AK
• Resolution: 3.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	H28 Y29 V30 W32 R33 R36 R40 R51 N55 R58 I75 A76 R80 C83 P84 V85 R86 N89 R90 T94 R96 P97 R98 V100 K101 R102 I109 R112 R125 A126 T127 W128	H1 Y2 V3 W5 R6 R9 R13 R24 N28 R31 I48 A49 R53 C56 P57 V58 R59 N62 R63 T67 R69 P70 R71 V73 K74 R75 I82 R85 R98 A99 T100 W101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome

External links

• PDB: RCSB:6nu2, PDBe:6nu2, PDBj:6nu2
• PDBsum: 6nu2
• PubMed: 30962385
• UniProt: O60783|RT14_HUMAN Small ribosomal subunit protein uS14m (Gene Name=MRPS14)