Structure of PDB 6fxc Chain AK

Receptor sequence

>6fxcAK (length=137) Species: 273036 (Staphylococcus aureus RF122)

MLLPKRVKYRRQHRPKTTGRSKGGNYVTFGEFGLQATTTSWITSRQIESA
RIAMTRYMKRGGKVWIKIFPHTPYTKKPLEVRMGAGKGAVEGWIAVVKPG
RILFEVAGVSEEVAREALRLASHKLPVKTKFVKREEL

3D structure

• PDB: 6fxc The cryo-EM structure of hibernating 100S ribosome dimer from pathogenic Staphylococcus aureus.
• Chain: AK
• Resolution: 6.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	P4 R6 K8 Y9 R11 Q12 H13 R14 K22 G24 F29 W41 Q46 S49 R56 W65 F69 H71 K77 R82 M83 G84 G86 K87 R101 R119 H123 K124 P126 K128	P4 R6 K8 Y9 R11 Q12 H13 R14 K22 G24 F29 W41 Q46 S49 R56 W65 F69 H71 K77 R82 M83 G84 G86 K87 R101 R119 H123 K124 P126 K128
BS02	rna	AK	T17 T39	T17 T39

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6fxc, PDBe:6fxc, PDBj:6fxc
• PDBsum: 6fxc
• PubMed: 28959035
• UniProt: Q2YYQ3|RL16_STAAB Large ribosomal subunit protein uL16 (Gene Name=rplP)