Structure of PDB 5on6 Chain AK

Receptor sequence

>5on6AK (length=87) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

GKGTPSFGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKTRSYNWGA
KAKRRHTTGTGRMRYLKHVSRRFKNGFQTGSASKASA

3D structure

PDB

5on6 The Amaryllidaceae Alkaloid Haemanthamine Binds the Eukaryotic Ribosome to Repress Cancer Cell Growth.

Chain

Resolution

3.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AK	G2 K3 G4 T5 P6 F8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 K31 S35 S36 K43 T44 R45 Y47 N48 W49 K52 A53 R55 R56 T59 K75	G1 K2 G3 T4 P5 F7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 K30 S34 S35 K42 T43 R44 Y46 N47 W48 K51 A52 R54 R55 T58 K74
BS02	rna	AK	T17 R21 C22 G23 V29 K32 A42 T59 G60 G62 R63 M64 R65 Y66 L67 K68 V70 R72 F74 N76 Q79 G81 S82 A83 K85 A86 S87 A88	T16 R20 C21 G22 V28 K31 A41 T58 G59 G61 R62 M63 R64 Y65 L66 K67 V69 R71 F73 N75 Q78 G80 S81 A82 K84 A85 S86 A87
BS03	OHX	AK	T44 S46	T43 S45
BS04	ZN	AK	C19 C22 C34 C37	C18 C21 C33 C36
BS05	OHX	AK	A86 S87 A88	A85 S86 A87

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0008270	zinc ion binding
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0000448	cleavage in ITS2 between 5.8S rRNA and LSU-rRNA of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:0030687	preribosome, large subunit precursor
GO:0044391	ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:5on6, PDBe:5on6, PDBj:5on6
PDBsum	5on6
PubMed	29429877
UniProt	P49166\|RL37A_YEAST Large ribosomal subunit protein eL37A (Gene Name=RPL37A)