Structure of PDB 5myj Chain AK

Receptor sequence
>5myjAK (length=118) Species: 416870 (Lactococcus cremoris subsp. cremoris MG1363) [Search protein sequence]
RRVKKNIESGIVHIQSTFNNTIVMITDVHGNALAWSSAGALGFKGSKKST
PFAAQMASEAAAKAAQEQGLKTVSVTVKGPGSGRESAIRALAAAGLNVTS
ISDVTPVPHNGARPPKRR
3D structure
PDB5myj A general mechanism of ribosome dimerization revealed by single-particle cryo-electron microscopy.
ChainAK
Resolution5.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AK H20 N26 N27 I29 M31 T33 H36 G37 N38 L40 W42 S44 G46 A47 K51 G52 S53 K55 K85 P113 V114 P115 H116 N117 P122 K123 R125 H13 N19 N20 I22 M24 T26 H29 G30 N31 L33 W35 S37 G39 A40 K44 G45 S46 K48 K78 P106 V107 P108 H109 N110 P115 K116 R118
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5myj, PDBe:5myj, PDBj:5myj
PDBsum5myj
PubMed28959045
UniProtA2RNM8|RS11_LACLM Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]