Structure of PDB 5aj0 Chain AK

Receptor sequence
>5aj0AK (length=109) Species: 9606 (Homo sapiens) [Search protein sequence]
MPREDRATWKSNYFLKIIQLLDDYPKCFIVGADNVGSKQMQQIRMSLRGK
AVVLMGKNTMMRKAIRGHLENNPALEKLLPHIRGNVGFVFTKEDLTEIRD
MLLANKVPA
3D structure
PDB5aj0 Structural Snapshots of Actively Translating Human Ribosomes
ChainAK
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AK K10 F14 D33 N34 V35 G36 S37 K38 M40 Q41 R44 V53 L54 M55 G56 K57 N58 T59 M60 R62 K63 I82 R83 G84 K10 F14 D33 N34 V35 G36 S37 K38 M40 Q41 R44 V53 L54 M55 G56 K57 N58 T59 M60 R62 K63 I82 R83 G84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005829 cytosol
GO:0005840 ribosome
GO:0005925 focal adhesion
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0022625 cytosolic large ribosomal subunit
GO:0022626 cytosolic ribosome
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0070062 extracellular exosome
GO:0098794 postsynapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:5aj0, PDBe:5aj0, PDBj:5aj0
PDBsum5aj0
PubMed25957688
UniProtP05388|RLA0_HUMAN Large ribosomal subunit protein uL10 (Gene Name=RPLP0)

[Back to BioLiP]