Structure of PDB 4w29 Chain AK

Receptor sequence
>4w29AK (length=119) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB4w29 How the ribosome hands the A-site tRNA to the P site during EF-G-catalyzed translocation.
ChainAK
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AK R12 Y20 N26 N27 I29 G37 N38 P39 W42 G46 V47 K51 G52 S53 K55 P113 V114 P115 H116 N117 G118 C119 R120 K122 K123 K124 R2 Y10 N16 N17 I19 G27 N28 P29 W32 G36 V37 K41 G42 S43 K45 P103 V104 P105 H106 N107 G108 C109 R110 K112 K113 K114
BS02 rna AK K127 S129 K117 S119
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4w29, PDBe:4w29, PDBj:4w29
PDBsum4w29
PubMed25190797
UniProtP62654|RS11_THET2 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]