Structure of PDB 4v9h Chain AK

Receptor sequence

>4v9hAK (length=119) Species: 300852 (Thermus thermophilus HB8)

KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS

3D structure

• PDB: 4v9h Elongation factor G bound to the ribosome in an intermediate state of translocation.
• Chain: AK
• Resolution: 2.857 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	R12 Y20 H22 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 V47 K51 G52 S53 K55 R85 V114 H116 N117 G118 C119 R120 P121 K122 K123 K124	R2 Y10 H12 N16 N17 I19 T21 G27 N28 P29 W32 S34 G36 V37 K41 G42 S43 K45 R75 V104 H106 N107 G108 C109 R110 P111 K112 K113 K114

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v9h, PDBe:4v9h, PDBj:4v9h
• PDBsum: 4v9h
• PubMed: 23812720
• UniProt: P80376|RS11_THET8 Small ribosomal subunit protein uS11 (Gene Name=rpsK)