Structure of PDB 4v8y Chain AK

Receptor sequence
>4v8yAK (length=96) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
MLMPKEDRNKIHQYLFQEGVVVAKKDFNQAKHEEIDTKNLYVIKALQSLT
SKGYVKTQFSWQYYYYTLTEEGVEYLREYLNLPEHIVPGTYIQERN
3D structure
PDB4v8y Molecular architecture of a eukaryotic translational initiation complex.
ChainAK
Resolution4.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AK M1 L2 M3 K5 K25 K44 S48 S51 F59 Y64 M1 L2 M3 K5 K25 K44 S48 S51 F59 Y64
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0000054 ribosomal subunit export from nucleus
GO:0002181 cytoplasmic translation
GO:0034198 cellular response to amino acid starvation
GO:0045860 positive regulation of protein kinase activity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8y, PDBe:4v8y, PDBj:4v8y
PDBsum4v8y
PubMed24200810
UniProtQ08745|RS10A_YEAST Small ribosomal subunit protein eS10A (Gene Name=RPS10A)

[Back to BioLiP]