Structure of PDB 4v83 Chain AK

Receptor sequence
>4v83AK (length=119) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
KRQVASGRAYIHASYNNTIVTITDPDGNPITWSSGGVIGYKGSRKGTPYA
AQLAALDAAKKAMAYGMQSVDVIVRGTGAGREQAIRALQASGLQVKSIVD
DTPVPHNGCRPKKKFRKAS
3D structure
PDB4v83 Crystal structures of complexes containing domains from two viral internal ribosome entry site (IRES) RNAs bound to the 70S ribosome.
ChainAK
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AK Y20 N26 N27 I29 T31 G37 N38 P39 W42 S44 G46 V47 G52 S53 K55 R85 V114 P115 H116 N117 G118 C119 R120 K122 K123 K124 Y10 N16 N17 I19 T21 G27 N28 P29 W32 S34 G36 V37 G42 S43 K45 R75 V104 P105 H106 N107 G108 C109 R110 K112 K113 K114
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v83, PDBe:4v83, PDBj:4v83
PDBsum4v83
PubMed21245352
UniProtP62654|RS11_THET2 Small ribosomal subunit protein uS11 (Gene Name=rpsK)

[Back to BioLiP]