Structure of PDB 4v7h Chain AK

Receptor sequence
>4v7hAK (length=125) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence]
DNSQVFGVARIYASFNDTFVHVTDLSGKETIARVTGGMKVKADRDESSPY
AAMLAAQDVAAKCKEVGITAVHVKIRATGGTRTKTPGPGGQAALRALARS
GLRIGRIEDVTPVPSDSTRKKGGRR
3D structure
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
ChainAK
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AK R18 Y20 S22 N24 D25 F27 H29 G35 E37 R41 T43 G44 G45 K49 D51 R52 R84 R127 K128 K129 G130 G131 R132 R133 R10 Y12 S14 N16 D17 F19 H21 G27 E29 R33 T35 G36 G37 K41 D43 R44 R76 R119 K120 K121 G122 G123 R124 R125
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Tue Nov 26 23:14:13 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'AK', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='AK', title='Comprehensive molecular structure of the eukaryotic ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v7h', asym_id = 'AK'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v7h', asym_id='AK')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>