Structure of PDB 4v6u Chain AK

Receptor sequence

>4v6uAK (length=135) Species: 186497 (Pyrococcus furiosus DSM 3638)

MRIIQTTGKRKTAIARAVIREGKGRVRINGKPVEIIEPEIARFTILEPLI
LAGEEIWNSVDIDVKVEGGGFMGQAEAARMAIARALVEWTGDMSLKEKFM
KYDRTMLVGDPRRTEPHKPNRSTKGPRAKRQKSYR

3D structure

• PDB: 4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
• Chain: AK
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	M1 Q5 K9 R10 K11 I14 R16 V18 R20 K23 R25 R27 I35 E37 P38 K65 E67 G68 G69 G70 F71 G73 V108 D110 P111 R112 R113 E115 P116 H117 K118 P119 S122 K124 P126 R127 K129 R130 Q131 K132 Y134	M1 Q5 K9 R10 K11 I14 R16 V18 R20 K23 R25 R27 I35 E37 P38 K65 E67 G68 G69 G70 F71 G73 V108 D110 P111 R112 R113 E115 P116 H117 K118 P119 S122 K124 P126 R127 K129 R130 Q131 K132 Y134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
• PDBsum: 4v6u
• PubMed: 23222135
• UniProt: Q8U0E7|RS9_PYRFU Small ribosomal subunit protein uS9 (Gene Name=rps9)