Structure of PDB 4v6s Chain AK

Receptor sequence

>4v6sAK (length=141) Species: 562 (Escherichia coli) [Search protein sequence]

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

3D structure

PDB

4v6s Structural characterization of mRNA-tRNA translocation intermediates.

Chain

Resolution

13.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	A1 K2 K3 V4 Q5 A6 Y7 V8 K9 L10 Q11 V12 A13 M16 P21 P22 P25 A26 L52 P53 P55 A62 K71 P74 A75 S87 G90 P92 K112 D115 M116 T117 R126 S127 I128 G130 T131 R133	A1 K2 K3 V4 Q5 A6 Y7 V8 K9 L10 Q11 V12 A13 M16 P21 P22 P25 A26 L52 P53 P55 A62 K71 P74 A75 S87 G90 P92 K112 D115 M116 T117 R126 S127 I128 G130 T131 R133

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070180	large ribosomal subunit rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0006415	translational termination
GO:0015968	stringent response

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v6s, PDBe:4v6s, PDBj:4v6s
PDBsum	4v6s
PubMed	22467828
UniProt	P0A7J7\|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)