Structure of PDB 4v64 Chain AK

Receptor sequence

>4v64AK (length=117) Species: 562 (Escherichia coli) [Search protein sequence]

RKQVSDGVAHIHASFNNTIVTITDRQGNALGWATAGGSGFRGSRKSTPFA
AQVAAERCADAVKEYGIKNLEVMVKGPGPGRESTIRALNAAGFRITNITD
VTPIPHNGCRPPKKRRV

3D structure

PDB

4v64 Structural basis for hygromycin B inhibition of protein biosynthesis

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	H21 N27 N28 I30 T32 G38 N39 A40 W43 T45 G47 G48 R52 G53 S54 K56 K86 P114 I115 H117 N118 G119 C120 R121 P123 K124 K125 R126 R127 V128	H10 N16 N17 I19 T21 G27 N28 A29 W32 T34 G36 G37 R41 G42 S43 K45 K75 P103 I104 H106 N107 G108 C109 R110 P112 K113 K114 R115 R116 V117

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0070181	small ribosomal subunit rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v64, PDBe:4v64, PDBj:4v64
PDBsum	4v64
PubMed	18567815
UniProt	P0A7R9\|RS11_ECOLI Small ribosomal subunit protein uS11 (Gene Name=rpsK)