Structure of PDB 8q5i Chain AJ

Receptor sequence
>8q5iAJ (length=97) Species: 5476 (Candida albicans) [Search protein sequence]
AKSGIAAGVNKGRKTTAKEVAPKISYRKGASSQRTVFVRSIVKEVAGLAP
YERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMTQVIAESRR
3D structure
PDB8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
ChainAJ
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AJ G13 R14 T16 K24 I25 S26 Y27 R28 K29 G30 S32 S33 R35 T36 R40 Y52 K66 R67 K69 R75 G77 T78 H79 R81 K85 G12 R13 T15 K23 I24 S25 Y26 R27 K28 G29 S31 S32 R34 T35 R39 Y51 K65 R66 K68 R74 G76 T77 H78 R80 K84
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum8q5i
PubMed
UniProtP47834|RL36_CANAX Large ribosomal subunit protein eL36 (Gene Name=RPL36)

[Back to BioLiP]