Structure of PDB 8oeq Chain AJ

Receptor sequence

>8oeqAJ (length=97) Species: 5476 (Candida albicans)

AKSGIAAGVNKGRKTTAKEVAPKISYRKGASSQRTVFVRSIVKEVAGLAP
YERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMTQVIAESRR

3D structure

• PDB: 8oeq Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: AJ
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AJ	G13 R14 T16 K24 I25 S26 Y27 R28 K29 G30 S32 S33 Q34 R35 T36 R40 Y52 E58 R61 N62 K66 R67 K73 R75 L76 G77 H79 R81 R84 R97	G12 R13 T15 K23 I24 S25 Y26 R27 K28 G29 S31 S32 Q33 R34 T35 R39 Y51 E57 R60 N61 K65 R66 K72 R74 L75 G76 H78 R80 R83 R96

External links

• PDB: RCSB:8oeq, PDBe:8oeq, PDBj:8oeq
• PDBsum: 8oeq
• UniProt: P47834|RL36_CANAX Large ribosomal subunit protein eL36 (Gene Name=RPL36)