Structure of PDB 7wfd Chain AJ

Receptor sequence
>7wfdAJ (length=42) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
MRDLKTYLSVAPVLSTLWFGSLAGLLIEINRLFPDALTFPFF
3D structure
PDB7wfd Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
ChainAJ
Resolution3.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA AJ A11 P12 S15 T16 F19 A11 P12 S15 T16 F19
BS02 CLA AJ N30 D35 A36 N30 D35 A36
BS03 CLA AJ L14 S15 W18 L14 S15 W18
BS04 CLA AJ W18 F19 L22 W18 F19 L22
BS05 CLA AJ S21 L25 E28 R31 S21 L25 E28 R31
Gene Ontology
Molecular Function
GO:0003674 molecular_function
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009507 chloroplast
GO:0009522 photosystem I
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7wfd, PDBe:7wfd, PDBj:7wfd
PDBsum7wfd
PubMed35123031
UniProtP56769|PSAJ_ARATH Photosystem I reaction center subunit IX (Gene Name=psaJ)

[Back to BioLiP]