Structure of PDB 7q08 Chain AJ

Receptor sequence
>7q08AJ (length=98) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
MAKSGIAAGVNKGRKTTAKEVAPKISYRKGASSQRTVFVRSIVKEVAGLA
PYERRLIELIRNAGEKRAKKLAKKRLGTHKRALRKVEEMTQVIAESRR
3D structure
PDB7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.
ChainAJ
Resolution2.56 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AJ G13 R14 T16 K24 I25 S26 Y27 R28 K29 G30 A31 S32 S33 Q34 R35 T36 R40 Y52 K66 R67 R75 G77 T78 H79 R81 R84 K85 G13 R14 T16 K24 I25 S26 Y27 R28 K29 G30 A31 S32 S33 Q34 R35 T36 R40 Y52 K66 R67 R75 G77 T78 H79 R81 R84 K85
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7q08, PDBe:7q08, PDBj:7q08
PDBsum7q08
PubMed35613268
UniProtA0A1D8PH21|RL36_CANAL Large ribosomal subunit protein eL36 (Gene Name=RPL36)

[Back to BioLiP]