Structure of PDB 6zse Chain AJ

Receptor sequence

>6zseAJ (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]

ATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKC
CRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKY
DCGHVQKK

3D structure

PDB

6zse Structural basis of mitochondrial translation.

Chain

Resolution

5.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AJ	A31 T32 N34 Q35 P41 P42 K43 R47 G54 R55 P56 Q57 K59 K71 K72 N74 S75 A76 N77 R78 K79 G97 E98 E111 G112 R114 Q116 D117 P119 K122 H134 K137 K138	A1 T2 N4 Q5 P11 P12 K13 R17 G24 R25 P26 Q27 K29 K41 K42 N44 S45 A46 N47 R48 K49 G67 E68 E81 G82 R84 Q86 D87 P89 K92 H104 K107 K108

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zse, PDBe:6zse, PDBj:6zse
PDBsum	6zse
PubMed	32812867
UniProt	O15235\|RT12_HUMAN Small ribosomal subunit protein uS12m (Gene Name=MRPS12)