Structure of PDB 6vmi Chain AJ

Receptor sequence
>6vmiAJ (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]
ATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKC
CRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKY
DCGHVQKK
3D structure
PDB6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
ChainAJ
Resolution2.96 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AJ A31 N34 Q35 R38 R55 P56 Q57 K59 K71 N74 S75 A76 N77 R78 P96 G97 E98 E111 R114 Q116 D117 K122 G128 K129 A1 N4 Q5 R8 R25 P26 Q27 K29 K41 N44 S45 A46 N47 R48 P66 G67 E68 E81 R84 Q86 D87 K92 G98 K99
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005761 mitochondrial ribosome
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
PDBsum6vmi
PubMed32737313
UniProtO15235|RT12_HUMAN Small ribosomal subunit protein uS12m (Gene Name=MRPS12)

[Back to BioLiP]