Structure of PDB 5xth Chain AJ

Receptor sequence

>5xthAJ (length=378) Species: 9606 (Homo sapiens) [Search protein sequence]

TPMRKTNPLMKLINHSFIDLPTPSNISAWWNFGSLLGACLILQITTGLFL
AMHYSPDASTAFSSIAHITRDVNYGWIIRYLHANGASMFFICLFLHIGRG
LYYGSFLYSETWNIGIILLLATMATAFMGYVLPWGQMSFWGATVITNLLS
AIPYIGTDLVQWIWGGYSVDSPTLTRFFTFHFILPFIIAALATLHLLFLH
ETGSNNPLGITSHSDKITFHPYYTIKDALGLLLFLLSLMTLTLFSPDLLG
DPDNYTLANPLNTPPHIKPEWYFLFAYTILRSVPNKLGGVLALLLSILIL
AMIPILHMSKQQSMMFRPLSQSLYWLLAADLLILTWIGGQPVSYPFTIIG
QVASVLYFTTILILMPTISLIENKMLKW

3D structure

PDB

5xth Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.

Chain

Resolution

3.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	AJ	Q44 I45 G48 L49 L51 A52 R80 H83 A87 G130 L133 P134 H182 F183 P186	Q43 I44 G47 L48 L50 A51 R79 H82 A86 G129 L132 P133 H181 F182 P185
BS02	HEM	AJ	W31 G34 L37 L94 H97 I98 R100 S106 Y109 W113 G116 L119 H196 L200 N206	W30 G33 L36 L93 H96 I97 R99 S105 Y108 W112 G115 L118 H195 L199 N205

Gene Ontology

	Molecular Function
GO:0008121	ubiquinol-cytochrome-c reductase activity
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0044877	protein-containing complex binding
GO:0046872	metal ion binding

	Biological Process
GO:0001666	response to hypoxia
GO:0006122	mitochondrial electron transport, ubiquinol to cytochrome c
GO:0007584	response to nutrient
GO:0009410	response to xenobiotic stimulus
GO:0009636	response to toxic substance
GO:0009725	response to hormone
GO:0014070	response to organic cyclic compound
GO:0015990	electron transport coupled proton transport
GO:0022904	respiratory electron transport chain
GO:0031100	animal organ regeneration
GO:0033590	response to cobalamin
GO:0033762	response to glucagon
GO:0045333	cellular respiration
GO:0045471	response to ethanol
GO:0046686	response to cadmium ion
GO:0046688	response to copper ion
GO:0046689	response to mercury ion
GO:0051592	response to calcium ion
GO:0055093	response to hyperoxia

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0016020	membrane
GO:0032991	protein-containing complex
GO:0045275	respiratory chain complex III

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:5xth, PDBe:5xth, PDBj:5xth
PDBsum	5xth
PubMed	28844695
UniProt	P00156\|CYB_HUMAN Cytochrome b (Gene Name=MT-CYB)

[Back to BioLiP]