Structure of PDB 5a9z Chain AJ

Receptor sequence
>5a9zAJ (length=134) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
VVAVVKLQLPAGKATPAPPVGPALGQHGANIMEFVKAFNAATANMGDAIV
PVEITIYADRSFTFVTKTPPASYLIRKAAGLEKGAHKPGREKVGRITWEQ
VLEIAKQKMPDLNTTDLEAAARMIAGSARSMGVE
3D structure
PDB5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
ChainAJ
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AJ Q11 P21 A26 I52 P73 A74 S75 Y76 K86 G87 K90 P91 N116 D119 R125 M126 A128 G129 S130 R132 S133 E137 Q8 P18 A23 I49 P70 A71 S72 Y73 K83 G84 K87 P88 N113 D116 R122 M123 A125 G126 S127 R129 S130 E134
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
PDBsum5a9z
PubMed26283392
UniProtQ5SLP6|RL11_THET8 Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]