Structure of PDB 4v9d Chain AJ

Receptor sequence
>4v9dAJ (length=98) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
RIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLIS
PHVNKDARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISL
3D structure
PDB4v9d Structures of the bacterial ribosome in classical and hybrid states of tRNA binding.
ChainAJ
Resolution3.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AJ R7 R9 K11 H15 D19 R37 G38 P39 I40 P41 L42 P43 T44 R45 E47 T50 I53 S54 P55 H56 V57 N58 K59 R62 Q64 R68 H70 R72 L73 D75 R3 R5 K7 H11 D15 R33 G34 P35 I36 P37 L38 P39 T40 R41 E43 T46 I49 S50 P51 H52 V53 N54 K55 R58 Q60 R64 H66 R68 L69 D71
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0001072 transcription antitermination factor activity, RNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0031564 transcription antitermination
GO:0032784 regulation of DNA-templated transcription elongation
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0008023 transcription elongation factor complex
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v9d, PDBe:4v9d, PDBj:4v9d
PDBsum4v9d
PubMed21596992
UniProtP0A7R5|RS10_ECOLI Small ribosomal subunit protein uS10 (Gene Name=rpsJ)

[Back to BioLiP]