Structure of PDB 4v7h Chain AJ

Receptor sequence
>4v7hAJ (length=96) Species: 5541 (Thermomyces lanuginosus) [Search protein sequence]
KIRITLTSTKVKQLENVSSNIVKNAEQHNLVKKGPVRLPTKVLKISTRKT
PNGEGSKTWETYEMRIHKRYIDLEAPVQIVKRITQITIEPGVDVEV
3D structure
PDB4v7h Comprehensive molecular structure of the eukaryotic ribosome.
ChainAJ
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AJ K21 R23 V31 K53 G54 P55 V56 R57 L58 P59 K61 L63 K64 S66 T67 R68 K69 T70 N72 G73 E74 K77 T78 W79 E80 T81 R85 H87 R89 Y90 K1 R3 V11 K33 G34 P35 V36 R37 L38 P39 K41 L43 K44 S46 T47 R48 K49 T50 N52 G53 E54 K57 T58 W59 E60 T61 R65 H67 R69 Y70
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 30 03:15:01 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v7h', asym_id = 'AJ', title = 'Comprehensive molecular structure of the eukaryotic ribosome.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v7h', asym_id='AJ', title='Comprehensive molecular structure of the eukaryotic ribosome.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003723,0003735,0005840,0006412,0015935', uniprot = '', pdbid = '4v7h', asym_id = 'AJ'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0005840,0006412,0015935', uniprot='', pdbid='4v7h', asym_id='AJ')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>