Structure of PDB 4v6u Chain AJ

Receptor sequence

>4v6uAJ (length=127) Species: 186497 (Pyrococcus furiosus DSM 3638)

MAIWQGRSLKKPSGGRIVLARKKRKRELGREPSNTRVAEQDKRKIIRTYG
GNRKVRLTAAAYANVFDKSGKGRKVRIIRVIENPANRQFARRNIITKGAI
IETEIGKAKVTSRPGQDGVVNAILLEE

3D structure

• PDB: 4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
• Chain: AJ
• Resolution: 6.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AJ	M1 I3 W4 Q5 R7 L9 K11 P12 S13 G14 R16 I17 A20 K22 K23 R24 K25 R26 R30 E31 P32 R43 T48 Y49 G50 R56 F66 K68 S69 G70 G72 R73 K74 P84 A85 N86 T96 K97 G98 T111 R113 Q116 D117 V119	M1 I3 W4 Q5 R7 L9 K11 P12 S13 G14 R16 I17 A20 K22 K23 R24 K25 R26 R30 E31 P32 R43 T48 Y49 G50 R56 F66 K68 S69 G70 G72 R73 K74 P84 A85 N86 T96 K97 G98 T111 R113 Q116 D117 V119
BS02	rna	AJ	R79 Q88 R91 R92 E102	R79 Q88 R91 R92 E102

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000462 maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
• PDBsum: 4v6u
• PubMed: 23222135
• UniProt: Q8U1Y5|RS8E_PYRFU Small ribosomal subunit protein eS8 (Gene Name=rps8e)