Structure of PDB 4v6o Chain AJ

Receptor sequence

>4v6oAJ (length=178) Species: 562 (Escherichia coli)

PRRRVIGQRKILPDPKFGSELLAKFVNILMVDGKKSTAESIVYSALETLA
QRSGKSELEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALAM
RWIVEAARKRGDKSMALRLANELSDAAENKGTAVKKREDVHRMAEANKAF
AHYRWLSLRSFSHQAGASSKQPALGYLN

3D structure

• PDB: 4v6o Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AJ
• Resolution: 14.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AJ	P1 R2 R3 R4 V5 I6 G7 Q8 R9 K10 K24 N27 M30 V31 D32 G33 K34 T37 I41 K75 S76 R77 R78 S82 R91 V93 R94 A97 R101 D112 K113 S114 M115 R118 H152 R159 S160 F161 S162 H163 A165 G166 P172 L174 G175 L177	P1 R2 R3 R4 V5 I6 G7 Q8 R9 K10 K24 N27 M30 V31 D32 G33 K34 T37 I41 K75 S76 R77 R78 S82 R91 V93 R94 A97 R101 D112 K113 S114 M115 R118 H152 R159 S160 F161 S162 H163 A165 G166 P172 L174 G175 L177
BS02	rna	AJ	W155 L156 L158 R159 S162	W155 L156 L158 R159 S162

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0017148 negative regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0016020 membrane
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
• PDBsum: 4v6o
• PubMed: 22467828
• UniProt: P02359|RS7_ECOLI Small ribosomal subunit protein uS7 (Gene Name=rpsG)