Structure of PDB 4v6k Chain AJ

Receptor sequence

>4v6kAJ (length=141) Species: 83333 (Escherichia coli K-12)

AKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAKTDSIEK
GLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKI
SRAQLQEIAQTKAADMTGADIEAMTRSIEGTARSMGLVVED

3D structure

• PDB: 4v6k Structural insights into cognate versus near-cognate discrimination during decoding.
• Chain: AJ
• Resolution: 8.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AJ	Q5 Y7 K9 L10 Q11 P25 A26 Q29 P74 A75 A76 K80 S87 G88 G90 K91 P92 N93 K94 K112 D115 M116 T117 G118 A123 R126 S127 G130 T131 R133 S134 M135	Q5 Y7 K9 L10 Q11 P25 A26 Q29 P74 A75 A76 K80 S87 G88 G90 K91 P92 N93 K94 K112 D115 M116 T117 G118 A123 R126 S127 G130 T131 R133 S134 M135

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination
• GO:0015968 stringent response

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6k, PDBe:4v6k, PDBj:4v6k
• PDBsum: 4v6k
• PubMed: 21378755
• UniProt: P0A7J7|RL11_ECOLI Large ribosomal subunit protein uL11 (Gene Name=rplK)