Structure of PDB 4v65 Chain AJ

Receptor sequence
>4v65AJ (length=80) Species: 562 (Escherichia coli) [Search protein sequence]
KIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNEC
GIGDVVEIRECRPLSKTKSWTLVRVVEKAV
3D structure
PDB4v65 The Structure of the E. coli Ribosome Before and After Accommodation: Implications for Proofreading
ChainAJ
Resolution9.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AJ K3 K15 M16 R26 F27 V28 H30 P31 I32 Y33 K35 K38 R39 K42 K68 K70 K1 K13 M14 R24 F25 V26 H28 P29 I30 Y31 K33 K36 R37 K40 K66 K68
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008270 zinc ion binding
GO:0019843 rRNA binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:4v65, PDBe:4v65, PDBj:4v65
PDBsum4v65
PubMed
UniProtP0AG63|RS17_ECOLI Small ribosomal subunit protein uS17 (Gene Name=rpsQ)

[Back to BioLiP]