Structure of PDB 3j9m Chain AJ

Receptor sequence

>3j9mAJ (length=108) Species: 9606 (Homo sapiens) [Search protein sequence]

ATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKC
CRVRLSTGREAVCFIPGEGHTLQEHQIVLVEGGRTQDLPGVKLTVVRGKY
DCGHVQKK

3D structure

PDB

3j9m Ribosome. The structure of the human mitochondrial ribosome.

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AJ	A31 T32 N34 Q35 R38 P41 P42 K43 G54 R55 P56 Q57 K59 K71 K72 N74 S75 A76 N77 R78 K79 S86 P96 G97 E98 E111 G112 R114 Q116 D117 P119 K122 G128 K129 H134	A1 T2 N4 Q5 R8 P11 P12 K13 G24 R25 P26 Q27 K29 K41 K42 N44 S45 A46 N47 R48 K49 S56 P66 G67 E68 E81 G82 R84 Q86 D87 P89 K92 G98 K99 H104

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005761	mitochondrial ribosome
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:3j9m, PDBe:3j9m, PDBj:3j9m
PDBsum	3j9m
PubMed	25838379
UniProt	O15235\|RT12_HUMAN Small ribosomal subunit protein uS12m (Gene Name=MRPS12)