Structure of PDB 8q5i Chain AI

Receptor sequence

>8q5iAI (length=119) Species: 5476 (Candida albicans) [Search protein sequence]

AGVKTFELRTKSKEQLESQLVELKQELATLKVQKLQRPSLPRIHTVRKNI
ARVLTVINLNQRENVRAFYAGKKYIPKDLRAKKTRALRRKLTKFEASQET
EKARKQRIAFPQRKFAIKA

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	G72 K74 Y75 R81 R86 R90 T93 K94 F95 A97 E102 K103 K106 R108 I109 F111 K115	G71 K73 Y74 R80 R85 R89 T92 K93 F94 A96 E101 K102 K105 R107 I108 F110 K114
BS02	rna	AI	G3 K5 T6 F7 R10 K35 S40 L41 P42 H45 R48 K49 A52 R53 L55 T56 N59 R63 K78 R81 A82 K83 T85 R86 R89	G2 K4 T5 F6 R9 K34 S39 L40 P41 H44 R47 K48 A51 R52 L54 T55 N58 R62 K77 R80 A81 K82 T84 R85 R88

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links