Structure of PDB 8cre Chain AI

Receptor sequence

>8creAI (length=120) Species: 5476 (Candida albicans)

MAGVKTFELRTKSKEQLESQLVELKQELATLKVQKLQRPSLPRIHTVRKN
IARVLTVINLNQRENVRAFYAGKKYIPKDLRAKKTRALRRKLTKFEASQE
TEKARKQRIAFPQRKFAIKA

3D structure

• PDB: 8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: AI
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	G72 K74 Y75 R81 R86 R90 T93 K94 F95 A97 S98 K103 K106 R108 I109	G72 K74 Y75 R81 R86 R90 T93 K94 F95 A97 S98 K103 K106 R108 I109
BS02	rna	AI	M1 A2 K5 F7 K35 P42 H45 R48 K49 A52 R53 L55 T56 N59 R63 K78 R81 A82 K83 T85 R86 R89	M1 A2 K5 F7 K35 P42 H45 R48 K49 A52 R53 L55 T56 N59 R63 K78 R81 A82 K83 T85 R86 R89

External links

• PDB: RCSB:8cre, PDBe:8cre, PDBj:8cre
• PDBsum: 8cre
• UniProt: A0A8H6F6B7