Structure of PDB 7qi4 Chain AI

Receptor sequence
>7qi4AI (length=137) Species: 9606 (Homo sapiens) [Search protein sequence]
TKFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPL
AFASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPG
RLSAMHGLIMGGLEVISITDNTPIPHAGCRPRKARKL
3D structure
PDB7qi4 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
ChainAI
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI H87 K89 N93 N94 Q96 Q98 N104 P106 S111 G113 T114 N119 A120 K122 K152 I181 P182 H183 X184 G185 C186 R187 P188 R189 K190 R192 K193 H30 K32 N36 N37 Q39 Q41 N47 P49 S54 G56 T57 N62 A63 K65 K95 I124 P125 H126 X127 G128 C129 R130 P131 R132 K133 R135 K136
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7qi4, PDBe:7qi4, PDBj:7qi4
PDBsum7qi4
PubMed38769321
UniProtP82912|RT11_HUMAN Small ribosomal subunit protein uS11m (Gene Name=MRPS11)

[Back to BioLiP]