Structure of PDB 7mpj Chain AI

Receptor sequence

>7mpjAI (length=205) Species: 4932 (Saccharomyces cerevisiae)

ARRPARCYRYQKNKPYPKSRYNRAVPDSKIRIYDLGKKKATVDEFPLCVH
LVSNELEQLSSEALEAARICANKYMTTVSGRDAFHLRVRVHPFHVLRINK
GMRGAWGKPHGLAARVDIGQIIFSVRTKDSNKDVVVEGLRRARYKFPGQQ
KIILSKKWGFTNLDRPEYLKKREAGEVKDDGAFVKFLSKKGSLENNIREF
PEYFA

3D structure

• PDB: 7mpj CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Chain: AI
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	R3 R4 A6 R7 C8 K13 K15 Y17 Y22 R24 Y34 D35 K39 S61 E63 A64 A67 K74 R90 H92 F94 R98 G114 M115 R116 W119 G120 Y157 K158 P160 Q162 D193 G194 F196 K198	R2 R3 A5 R6 C7 K12 K14 Y16 Y21 R23 Y33 D34 K38 S60 E62 A63 A66 K73 R89 H91 F93 R97 G101 M102 R103 W106 G107 Y144 K145 P147 Q149 D180 G181 F183 K185
BS02	rna	AI	Y11 E56 L57 K202 K203 G204 L206 F217	Y10 E55 L56 K189 K190 G191 L193 F204
BS03	MG	AI	R156 F159 G161 Q163	R143 F146 G148 Q150

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0006415 translational termination

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mpj, PDBe:7mpj, PDBj:7mpj
• PDBsum: 7mpj
• PubMed: 35489333
• UniProt: P41805|RL10_YEAST Large ribosomal subunit protein uL16 (Gene Name=RPL10)