Structure of PDB 6ztp Chain AI

Receptor sequence

>6ztpAI (length=128) Species: 562 (Escherichia coli)

ENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPL
ELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAG
FVTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 6ztp Structural basis of transcription-translation coupling and collision in bacteria.
• Chain: AI
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	Q5 Y7 T9 R11 R12 K13 S14 R18 F20 R33 Y38 Y64 G69 G70 G71 I72 S73 Q75 R85 R95 R99 V104 T105 R106 R109 Q110 V111 E112 R113 K114 K115 V116 G117 R119 K120 R122 R123 R124 Q126 F127 K129 R130	Q3 Y5 T7 R9 R10 K11 S12 R16 F18 R31 Y36 Y62 G67 G68 G69 I70 S71 Q73 R83 R93 R97 V102 T103 R104 R107 Q108 V109 E110 R111 K112 K113 V114 G115 R117 K118 R120 R121 R122 Q124 F125 K127 R128
BS02	rna	AI	K129 R130	K127 R128
BS03	MG	AI	Q32 Y64	Q30 Y62

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ztp, PDBe:6ztp, PDBj:6ztp
• PDBsum: 6ztp
• PubMed: 32820062
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)