Structure of PDB 6zsc Chain AI

Receptor sequence
>6zscAI (length=136) Species: 9606 (Homo sapiens) [Search protein sequence]
KFSIYPPIPGEESSLRWAGKKFEEIPIAHIKASHNNTQIQVVSASNEPLA
FASCGTEGFRNAKKGTGIAAQTAGIAAAARAKQKGVIHIRVVVKGLGPGR
LSAMHGLIMGGLEVISITDNTPIPHNGCRPRKARKL
3D structure
PDB6zsc Structural basis of mitochondrial translation.
ChainAI
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI H92 N93 N94 Q96 Q98 N104 P106 F109 G113 T114 N119 A120 K122 K152 I181 P182 H183 N184 G185 C186 R187 P188 R189 K190 R192 K193 H34 N35 N36 Q38 Q40 N46 P48 F51 G55 T56 N61 A62 K64 K94 I123 P124 H125 N126 G127 C128 R129 P130 R131 K132 R134 K135
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0006412 translation
GO:0032543 mitochondrial translation
Cellular Component
GO:0005739 mitochondrion
GO:0005743 mitochondrial inner membrane
GO:0005763 mitochondrial small ribosomal subunit
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6zsc, PDBe:6zsc, PDBj:6zsc
PDBsum6zsc
PubMed32812867
UniProtP82912|RT11_HUMAN Small ribosomal subunit protein uS11m (Gene Name=MRPS11)

[Back to BioLiP]