Structure of PDB 5el5 Chain AI

Receptor sequence
>5el5AI (length=81) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
RSLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVY
NGKQHVPVYITENMVGHKLGEFAPTRTYRGH
3D structure
PDB5el5 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
ChainAI
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI R3 S4 L5 K6 F10 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 Y80 H83 R1 S2 L3 K4 F8 H12 W32 R34 R35 Y50 N51 G52 K53 K68 G70 E71 T75 Y78 H81
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5el5, PDBe:5el5, PDBj:5el5
PDBsum5el5
PubMed26791911
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]