Structure of PDB 5el4 Chain AI

Receptor sequence
>5el4AI (length=80) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYN
GKQHVPVYITENMVGHKLGEFAPTRTYRGH
3D structure
PDB5el4 Novel base-pairing interactions at the tRNA wobble position crucial for accurate reading of the genetic code.
ChainAI
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI S4 L5 K6 F10 H14 K18 W34 R36 R37 Y52 N53 G54 K55 K70 G72 E73 T77 Y80 H83 S1 L2 K3 F7 H11 K15 W31 R33 R34 Y49 N50 G51 K52 K67 G69 E70 T74 Y77 H80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5el4, PDBe:5el4, PDBj:5el4
PDBsum5el4
PubMed26791911
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]