Structure of PDB 4wt1 Chain AI

Receptor sequence
>4wt1AI (length=81) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
SLKKGVFVDDHLLEKVLELNAKGEKRLIKTWSRRSTIVPEMVGHTIAVYN
GKQHVPVYITENMVGHKLGEFAPTRTYRGHG
3D structure
PDB4wt1 Structural insights into the translational infidelity mechanism.
ChainAI
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI S4 L5 K6 F10 H14 W34 R36 R37 Y52 N53 G54 K55 K70 G72 T77 T79 Y80 H83 S1 L2 K3 F7 H11 W31 R33 R34 Y49 N50 G51 K52 K67 G69 T74 T76 Y77 H80
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4wt1, PDBe:4wt1, PDBj:4wt1
PDBsum4wt1
PubMed26037619
UniProtQ5SHP2|RS19_THET8 Small ribosomal subunit protein uS19 (Gene Name=rpsS)

[Back to BioLiP]