Structure of PDB 4v89 Chain AI

Receptor sequence

>4v89AI (length=127) Species: 562 (Escherichia coli) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

4v89 Crystal structure of release factor RF3 trapped in the GTP state on a rotated conformation of the ribosome.

Chain

Resolution

3.7 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	Q4 Y6 T8 R10 R11 K12 S13 R17 Y37 E41 G68 G69 G70 I71 S72 Q74 R98 T104 R105 R108 Q109 V110 E111 R112 K113 K114 V115 G116 K119 A120 R121 R122 R123 Q125 F126 R129	Q2 Y4 T6 R8 R9 K10 S11 R15 Y35 E39 G66 G67 G68 I69 S70 Q72 R96 T102 R103 R106 Q107 V108 E109 R110 K111 K112 V113 G114 K117 A118 R119 R120 R121 Q123 F124 R127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v89, PDBe:4v89, PDBj:4v89
PDBsum	4v89
PubMed	22187675
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)