Structure of PDB 4v74 Chain AI

Receptor sequence
>4v74AI (length=127) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR
3D structure
PDB4v74 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAI
Resolution17.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI R10 R11 K12 R17 Q31 T42 K67 G69 G70 R84 R98 T104 R105 R108 Q109 V110 E111 R112 K113 K114 V115 R118 R121 R122 Q125 F126 R129 R8 R9 K10 R15 Q29 T40 K65 G67 G68 R82 R96 T102 R103 R106 Q107 V108 E109 R110 K111 K112 V113 R116 R119 R120 Q123 F124 R127
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v74, PDBe:4v74, PDBj:4v74
PDBsum4v74
PubMed24186064
UniProtP0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]