Structure of PDB 4v73 Chain AI

Receptor sequence
>4v73AI (length=127) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR
3D structure
PDB4v73 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAI
Resolution15.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI R10 K12 A15 R17 R40 K67 G70 S72 R84 R94 R98 V103 T104 R105 A107 R108 Q109 K113 K114 R118 K119 R121 F126 S127 K128 R129 R8 K10 A13 R15 R38 K65 G68 S70 R82 R92 R96 V101 T102 R103 A105 R106 Q107 K111 K112 R116 K117 R119 F124 S125 K126 R127
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v73, PDBe:4v73, PDBj:4v73
PDBsum4v73
PubMed24186064
UniProtP0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)

[Back to BioLiP]