Structure of PDB 4v6o Chain AI

Receptor sequence
>4v6oAI (length=135) Species: 562 (Escherichia coli) [Search protein sequence]
MRHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYP
INKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEAS
PMVKAKDERRERRDDFANETADDAEAGDSEEEEEE
3D structure
PDB4v6o Structural characterization of mRNA-tRNA translocation intermediates.
ChainAI
Resolution14.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AI Y4 Y49 K53 Q68 I71 D72 E75 R79 F80 I85 R86 M88 V89 R91 K93 H94 Y4 Y49 K53 Q68 I71 D72 E75 R79 F80 I85 R86 M88 V89 R91 K93 H94
BS02 rna AI R45 Q46 L47 A48 E108 R112 R113 R45 Q46 L47 A48 E108 R112 R113
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
PDBsum4v6o
PubMed22467828
UniProtP02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]