Structure of PDB 4v6l Chain AI

Receptor sequence

>4v6lAI (length=166) Species: 83333 (Escherichia coli K-12)

AHIEKQAGELQEKLIAVNRVSKTVKGGRIFSFTALTVVGDGNGRVGFGYG
KAREVPAAIQKAMEKARRNMINVALNNGTLQHPVKGVHTGSRVFMQPASE
GTGIIAGGAMRAVLEVAGVHNVLAKAYGSTNPINVVRATIDGLENMNSPE
MVAAKRGKSVEEILGK

3D structure

• PDB: 4v6l Structural insights into cognate versus near-cognate discrimination during decoding.
• Chain: AI
• Resolution: 13.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	N18 V20 S21 K22 T23 V24 K25 Y49 K51 A52 K61 K65 H88 R92 S99 G101 T102 I104 I105 A106 G107 G108 M110 L123 K125 Y127 S129 T130 N131 I133 N134 R137	N18 V20 S21 K22 T23 V24 K25 Y49 K51 A52 K61 K65 H88 R92 S99 G101 T102 I104 I105 A106 G107 G108 M110 L123 K125 Y127 S129 T130 N131 I133 N134 R137
BS02	rna	AI	R19 R28 F30 F32	R19 R28 F30 F32

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0046677 response to antibiotic
• GO:1990145 maintenance of translational fidelity

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6l, PDBe:4v6l, PDBj:4v6l
• PDBsum: 4v6l
• PubMed: 21378755
• UniProt: P0A7W1|RS5_ECOLI Small ribosomal subunit protein uS5 (Gene Name=rpsE)