Structure of PDB 4v55 Chain AI

Receptor sequence

>4v55AI (length=127) Species: 562 (Escherichia coli) [Search protein sequence]

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

PDB

4v55 Structural basis for aminoglycoside inhibition of bacterial ribosome recycling.

Chain

Resolution

4.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AI	Y6 R10 R11 K12 S13 A15 R17 F19 Y37 K67 G68 G69 G70 I71 S72 Q74 R84 R98 V103 T104 R105 R108 Q109 V110 E111 R112 K113 K114 V115 G116 R118 K119 R121 R122 R123 P124 Q125 S127 R129	Y4 R8 R9 K10 S11 A13 R15 F17 Y35 K65 G66 G67 G68 I69 S70 Q72 R82 R96 V101 T102 R103 R106 Q107 V108 E109 R110 K111 K112 V113 G114 R116 K117 R119 R120 R121 P122 Q123 S125 R127

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:4v55, PDBe:4v55, PDBj:4v55
PDBsum	4v55
PubMed	17660832
UniProt	P0A7X3\|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)