Structure of PDB 8q5i Chain AH

Receptor sequence

>8q5iAH (length=112) Species: 5476 (Candida albicans) [Search protein sequence]

AQRVTYRRRNPYNTRSNKIKVVKTPGGKLVAQHVKKAASRVKCGDCGSAL
AGISTLRPRQYAQVSKTHKTVQRAYGGSRCANCVKERIVRAFLIEEQKIV
KRVLKEQQDKEK

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AH	A2 R4 V5 T6 Y7 R8 R9 R10 N11 P12 Y13 N14 T15 R16 S17 V23 K24 T25 P26 G27 L30 Q33 K36 K37 S40 R41 V42 K43 G45 A52 G53 I54 S55 T56 R58 P59 R60 Y62 A63 Q64 S66 K67 T68 K70 T71 V72 Q73 R74 Y76 G78 S79 A82 N83 R88 R91 A92 I95 E96 K99 K102	A1 R3 V4 T5 Y6 R7 R8 R9 N10 P11 Y12 N13 T14 R15 S16 V22 K23 T24 P25 G26 L29 Q32 K35 K36 S39 R40 V41 K42 G44 A51 G52 I53 S54 T55 R57 P58 R59 Y61 A62 Q63 S65 K66 T67 K69 T70 V71 Q72 R73 Y75 G77 S78 A81 N82 R87 R90 A91 I94 E95 K98 K101
BS02	MG	AH	G53 T68	G52 T67

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

External links