Structure of PDB 8ove Chain AH

Receptor sequence
>8oveAH (length=135) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]
YYGSSAGKDQLVYGVVHIYASFNDTFVHVTDMSGRETFCKVTGGMKVKAD
RDESSPYAAMMAAQDVVARCKECGINALHVKMRATGGVGTKSPGPGAQAA
LRALARAGMKIGRIEDVTPVPTDSTRRKGSRRGRR
3D structure
PDB8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.
ChainAH
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AH N31 D32 F34 H36 G42 E44 T45 T50 G52 M53 D58 V128 P129 T130 D131 R134 G137 S138 R139 R140 R142 R143 N23 D24 F26 H28 G34 E36 T37 T42 G44 M45 D50 V120 P121 T122 D123 R126 G129 S130 R131 R132 R134 R135
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ove, PDBe:8ove, PDBj:8ove
PDBsum8ove
PubMed37985661
UniProtP19800|RS14_TRYBB Small ribosomal subunit protein uS11 (Gene Name=RPS14)

[Back to BioLiP]