Structure of PDB 7q0f Chain AH

Receptor sequence

>7q0fAH (length=112) Species: 237561 (Candida albicans SC5314)

AQRVTYRRRNPYNTRSNKIKVVKTPGGKLVAQHVKKAASRVKCGDCGSAL
AGISTLRPRQYAQVSKTHKTVQRAYGGSRCANCVKERIVRAFLIEEQKIV
KRVLKEQQDKEK

3D structure

• PDB: 7q0f E-site drug specificity of the human pathogen Candida albicans ribosome.
• Chain: AH
• Resolution: 2.64 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AH	A2 R4 V5 T6 Y7 R8 R9 R10 P12 Y13 N14 T15 R16 S17 K24 T25 P26 G27 L30 K36 K37 S40 R41 V42 K43 A52 G53 I54 S55 T56 R58 P59 R60 S66 K67 T68 K70 T71 V72 Q73 R74 Y76 G78 A82 N83 R88 R91 A92 I95 E96 Q98 K99 K102	A1 R3 V4 T5 Y6 R7 R8 R9 P11 Y12 N13 T14 R15 S16 K23 T24 P25 G26 L29 K35 K36 S39 R40 V41 K42 A51 G52 I53 S54 T55 R57 P58 R59 S65 K66 T67 K69 T70 V71 Q72 R73 Y75 G77 A81 N82 R87 R90 A91 I94 E95 Q97 K98 K101

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation
• GO:0042254 ribosome biogenesis

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7q0f, PDBe:7q0f, PDBj:7q0f
• PDBsum: 7q0f
• PubMed: 35613268
• UniProt: A0A1D8PDZ1|RL34B_CANAL Large ribosomal subunit protein eL34 (Gene Name=RPL34B)